SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093PX70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093PX70
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0000000000000124
Family Preprotein translocase SecE subunit 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093PX70
Sequence length 66
Comment (tr|A0A093PX70|A0A093PX70_9PASS) Protein transport protein Sec61 subunit gamma {ECO:0000313|EMBL:KFW78805.1} KW=Complete proteome; Reference proteome OX=328815 OS=Manacus vitellinus (golden-collared manakin). GN=N305_04970 OC=Coelurosauria; Aves; Neognathae; Passeriformes; Pipridae; Manacus.
Sequence
MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIP
INNIIV
Download sequence
Identical sequences A0A060YNV9 A0A087QHR6 A0A087V3M8 A0A091ESH5 A0A091H3Y6 A0A091H655 A0A091HRN0 A0A091JMB7 A0A091K1I4 A0A091KIF7 A0A091LEM1 A0A091MKQ7 A0A091MVG7 A0A091NMF2 A0A091NX17 A0A091Q0R7 A0A091QJZ2 A0A091SAD1 A0A091TG50 A0A091TQ69 A0A091W4M6 A0A091XWX3 A0A093C3C9 A0A093G606 A0A093HXB1 A0A093HXG7 A0A093IRB5 A0A093NA84 A0A093PX70 A0A093R000 A0A094L180 A0A099Z7V3 A0A0A0ATF1 A0A0Q3UTT1 A0A1W5A0X7 A0A226MUP1 A0A287B1B1 A0A2I2UKG6 E6ZIH2 F6TPF7 G1MBP8 G1PCR7 G3T9W9 G3WGP8 G5AMM7 G7MLA0 G7P1R5 H0X2A4 I3M4X5 K7FDR8 L8HSS6 M7C6K8 R0K3Y6 S7MDX7
ENSFCAP00000021080 XP_004646694.1.9945 XP_004668917.1.11716 XP_004915421.1.99540 XP_007059423.1.26238 XP_008145384.1.99482 XP_009896605.1.92783 XP_012790515.1.94378 XP_013811191.1.3284 XP_015302887.1.63531 XP_018121800.1.7800 XP_018609542.1.37976 XP_020368219.1.65276 XP_020568409.1.28442 ENSMLUP00000008225 ENSACAP00000017108 ENSSHAP00000014603 HGL_H00000341538 ENSXETP00000034548 ENSSHAP00000014603 ENSXETP00000034548 ENSAMEP00000016776 ENSAMEP00000016776 ENSSTOP00000004322 8364.ENSXETP00000034548 ENSSTOP00000004322 ENSLAFP00000010618 ENSLAFP00000010618 ENSOGAP00000009176 ENSPSIP00000006178 ENSPSIP00000006178 ENSMLUP00000008225 ENSOGAP00000009176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]