SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093Q1S2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093Q1S2
Domain Number 1 Region: 236-434
Classification Level Classification E-value
Superfamily MIR domain 9.59e-67
Family MIR domain 0.00000000754
Further Details:      
 
Domain Number 2 Region: 436-601
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.83e-59
Family IP3 receptor type 1 binding core, domain 2 0.0000000215
Further Details:      
 
Domain Number 3 Region: 1131-1287
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.22e-36
Family IP3 receptor type 1 binding core, domain 2 0.0074
Further Details:      
 
Domain Number 4 Region: 108-219
Classification Level Classification E-value
Superfamily MIR domain 9.42e-20
Family MIR domain 0.015
Further Details:      
 
Domain Number 5 Region: 1239-1329,1425-1511,1540-1693,1970-2079
Classification Level Classification E-value
Superfamily ARM repeat 0.0000137
Family HspBP1 domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093Q1S2
Sequence length 2743
Comment (tr|A0A093Q1S2|A0A093Q1S2_9PASS) Inositol 1,4,5-trisphosphate receptor type 1 {ECO:0000313|EMBL:KFW82948.1} KW=Complete proteome; Reference proteome OX=328815 OS=Manacus vitellinus (golden-collared manakin). GN=N305_14736 OC=Coelurosauria; Aves; Neognathae; Passeriformes; Pipridae; Manacus.
Sequence
MTDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVNPDYEEDDLECQSSLDPEQDAARRGPRAQEKMAYSLVAVPEG
NDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGTS
PVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDLV
YFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEEL
GDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLHN
NRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPAN
ADILIETKLVLSRFEFEEVSSGENALDVGEDEEEVWLFWRDSNKEIRSKSIRELAQDAKE
GQKEDRDVLSYYRVGVCTWLCFWFSGVTAVLSAFCISLQAFSGPVVLSRTTLKFWTCPRV
GVVDVQSCSVQPRPSPVYLHAKLCVLFSFLFCSFFSLFSYDSSGTSKDEIKERFAQTMEF
VEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFCDLLRLTKILLAILDCVH
ITTIFPITKMAKGEESKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPLAAAPEGNVKQSE
PEKEDILVMDTKLKIIEILQFILNVRLDYRISCLLCIFKHEFDESNAQMSESPSGSSSQE
MPANVPGALDFEHIEEQAEGIFGGRKVSLHSEENTPLDLDDHGGRTFLRVLLHLTMHDYP
PLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWV
YKGQGPDEAMDSVPGENEHKKKEEGHSKSQKPESTSSYNYRVVKEILLRLSKLCVQEGAS
VRKSRKQQQRLLRNMGAHAVVLELLQIPYEKAEDTRMQEIMKLAHEFLQNFCAGNQQNQA
LLHKHINLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQ
TIVKAEGKFIKKCQDMVMAELVNAGEDVLVFYNDRASFQTLVQMMRSERDRMDENSPLMY
HIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDT
EVEMKEIYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSP
FSDQSTTLQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVD
LDSQVNNLFLKSHNIVQKTAMNWRMTARNAARRDSVLAASRDYRNIIERLQDIVSALEDR
LRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIK
VLQTLREMMTKDRGYGEKGVNSNYGYNSFLPQPPETESPVEQELDQTLPQRQLEDHRRGE
ALRQVLVNRYYGNVRPAGRRESLTTFGNGPLSAGGTGKAGAGGGSSGSSSMSRGEMSLAD
VQCHLDKEGASNLVIDLIMNATSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSE
KFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDEDSDRDVPNRKRVREPMTQITEEVRD
QLLEASAATRKAYNTYRREADPEEHYSAGEGAQAAADKSKDDLEMSAVISIMQPILRFLQ
LLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALIN
QTLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKASECF
VQFTFTNNASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYLQGEVEFEDGENGE
DVAASPRNVGHNIYILAHQLARHNKELQNMLKPGGQIEGDEALEFYAKHTAQIEIVRSDR
TMEQIVFPVPSICEFLTKESKLRIYYTTERDEQGSKINDFFLKSEDLFNEMNWQKKLRAQ
PFLYWCARNMSFWSSISFNLAVLMNLLVAFFYPFKGIRGGTLEPHLSGLLWTAMLISLAI
VIALPKPHGIRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGY
KAMIMDVEFLYHLLYLLICALGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIIL
TAVLALILVYLFSIVGYLFFKDDFILEVDKLPNETLLPEPGETMTGEFLYSDVCKAGSSE
NCSSIIPSDQVLTEEMEEENKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLF
AARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDN
KTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSL
VSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQVRER
Download sequence
Identical sequences A0A093Q1S2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]