SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093QRX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093QRX1
Domain Number 1 Region: 249-430
Classification Level Classification E-value
Superfamily MIR domain 8.63e-54
Family MIR domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093QRX1
Sequence length 667
Comment (tr|A0A093QRX1|A0A093QRX1_PHACA) Protein O-mannosyl-transferase 2 {ECO:0000313|EMBL:KFW91306.1} KW=Complete proteome; Reference proteome OX=9209 OS=Phalacrocorax carbo (Great cormorant) (Pelecanus carbo). GN=N336_08612 OC=Phalacrocorax.
Sequence
WDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYLSGYDGTFPFQKPGDRYEQHNYVG
MRGFCAFLGSCLVPFAYLTVLELSRSLPAALLTAFILIFDTGCITLSQYILLDPILMFFL
MGAVLCMVKCNSCADRPFSASWWFWLCLTGVNLAGAMGVKFVGLFVVLLVGLNTICDLWD
LLGDLSLSLVMFGKHLLARVLCLILLPLTLYTAMFAVHFTVLNKSGPGDGFFSSAFQSQL
IGNNLHNVSIPEYLAYGSVVTMKNLRMAGGYLHSHWHLYPEGIGARQQQVTAYLHKDLNN
LWIIKKHDLDTDLSDPSSPVEFVRHGDIIRLEHKETCRNLHSHQHEAPLTRKHFQVTGYG
INGTGDSNDFWRIEVVGGKAGKLIKVLRSQVRLTHVATGCILGSSGKTLPKWGWEQVEVT
CTPYLKETPNSLWNFEDHINPKLPNISLDVLKPSFAEILLESHMVMIRGNSGLKPKDNEV
TSKPWHWPINYQGLRFSGVNETDYRVYLLGNPVIWWLNLVTIGLYLLMAVSTAVTLKRGV
QLTSELKELSRVVLCGGGQITLGWLLHYLPFFLMGRVLYFHHYFPAMLFSSMLTGITWDT
LLKFCARVLSPRITARKVYGGGFLALVLLIIYSFYLFHPLSYGMIGPMASDPSSPMAGLR
WMDSWEF
Download sequence
Identical sequences A0A093QRX1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]