SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093QYB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093QYB1
Domain Number 1 Region: 4-241
Classification Level Classification E-value
Superfamily BEACH domain 7.32e-102
Family BEACH domain 0.00000000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093QYB1
Sequence length 242
Comment (tr|A0A093QYB1|A0A093QYB1_PHACA) Neurobeachin {ECO:0000313|EMBL:KFW91365.1} KW=Complete proteome; Reference proteome OX=9209 OS=Phalacrocorax carbo (Great cormorant) (Pelecanus carbo). GN=N336_09209 OC=Phalacrocorax.
Sequence
FLILKTLSFLIGRTYNDLNQYPVFPWVLTNYESEELDLTLPGNFRDLSKPIGALNPKRAV
FYAERYETWEDDQTPPYHYNTHYSTSTSTLAWLVRIEPFTTFFLNANDGKFDHPDRTFSS
VARSWRNSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGIREDEVVVNDVDLPPWAKKPED
FVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPV
LR
Download sequence
Identical sequences A0A091QFA4 A0A093QYB1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]