SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093SBA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093SBA0
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 9.02e-18
Family H-NS histone-like proteins 0.0001
Further Details:      
 
Domain Number 2 Region: 93-135
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0000000000106
Family H-NS histone-like proteins 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093SBA0
Sequence length 135
Comment (tr|A0A093SBA0|A0A093SBA0_9GAMM) DNA-binding protein {ECO:0000256|PIRNR:PIRNR002096} KW=Complete proteome OX=55207 OS=Pectobacterium betavasculorum. GN=KP22_04785 OC=Pectobacteriaceae; Pectobacterium.
Sequence
MSEALKILNNIRTLRAQARECTLDTLEEMLEKLEVVVNERREEDSQVQAEVEERARKLQQ
YRDMLIADGIDPNELLQSSGSVKVAGKSKRAARPAKYQYTDENGDAKTWTGQGRTPAVIK
KAIEEQGKSLDDFLL
Download sequence
Identical sequences A0A093SBA0
WP_039300045.1.37192 WP_039300045.1.75066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]