SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093UR20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093UR20
Domain Number 1 Region: 3-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.15e-87
Family Capz beta-1 subunit 0.0000000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093UR20
Sequence length 267
Comment (tr|A0A093UR20|A0A093UR20_TALMA) F-actin-capping protein subunit beta {ECO:0000313|EMBL:KFX42742.1} KW=Complete proteome; Reference proteome OX=1077442 OS=Talaromyces marneffei PM1. GN=GQ26_0410490 OC=Eurotiomycetidae; Eurotiales; Trichocomaceae; Talaromyces.
Sequence
MADTQFDSALDLLRRLSPRDTGKNLQSITNLVPDLTEDLLASVDQPLEVRRCLKSNRDYL
LCDYNRDGDSYRSPWSNEFDPPIEDGTVPSERVRKLEVAANEAFDVYRELYYEGGVGSVY
FWDLDDGFAGVVLLKKGVTPGGKSSGAWDSIHVFEATDRARMTHYKLTSTVILHLSNESD
ALGEMNLSGNMTRQVEADLPFESDASHVANVGRLVEDMELKMRNLLQEVYFGKAKDVVGD
LRSIAPLSETNQERAAHREMINSMSRR
Download sequence
Identical sequences A0A093UR20 B6QMY6
XP_002149935.1.75516 Pmar_ATCC_18224:PMAA_051360.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]