SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093VBH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093VBH8
Domain Number 1 Region: 345-545
Classification Level Classification E-value
Superfamily MIR domain 1.4e-59
Family MIR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093VBH8
Sequence length 942
Comment (tr|A0A093VBH8|A0A093VBH8_TALMA) Dolichyl-phosphate-mannose--protein mannosyltransferase 1 {ECO:0000313|EMBL:KFX49495.1} KW=Complete proteome; Reference proteome OX=1077442 OS=Talaromyces marneffei PM1. GN=GQ26_0091300 OC=Eurotiomycetidae; Eurotiales; Trichocomaceae; Talaromyces.
Sequence
MPSKSKDTLSVRPVSRGNNRSRSRSRSRSRSPNPKSKKSTPKKTKDYSSEGVTDNDIFKL
PASDYVWLAGLTLGAAAVRLFRIYQPSSVVFDEVHFGGFATKYIKGTFFMDVHPPLAKLL
ITLAAWLAGFQGDFSFSDIGMDYLEPGVPYVAMRLLPAILGVLTVPLMFLTLKATGCRTS
TSVMGAVLVTFDNALTTQSRFILLDSPLIFFTALTALSFACFTNQHEQGPSKAFKGAWWF
WLVLSGLSLGATLSVKWVGLFTTAWLGSITILQLWVLLGDSNTVTPRLWFKHFFARFFCL
VVIPLGFYIAMFGVHFLCLVNPGEGDGFMSSEFQATLNSKGMQDVPADVVYGSRVTIRHV
NTQGGYLHSHAHMYPTGSQQQQVTLYPHKDENNVFLLENQTQPVGADGAEIEGPMAWDNT
TAEYIYDGAVLRLYHLTTHRRIHSHDERAPITDADWQNEVSAYGYEGFPGDANDLFRVEI
VKSESDGEEAKKRLRTIQTKFRLIHVMTGCALFSHKVKLPDWAFDQQEVTCAKQGTLPNS
LWYIESNAHPALTEDAEKVNYRNPGFLGKFLELQRVMWTTNAGLTESHAWDSRPPSWPTL
LRGINFWGKDHRQVYLFGNPLIWWSSTATIALYIAFKGLAVLRWQRSCNDYKNVNFKRFD
YEVGTTVLGWAFHYFPFFLMARQLFLHHYLPALYFAIMALSQTFDFVLNRVQLPVIGKRS
IVGSGLIATFLALSVGVFVIYSPLTYANPWTTDACQSVKLLDSWDFNCAMFHANLDDYIT
PYSNANVPVKSQVPVAPIQNQNQQQPIGENPDGNKQYVTPQPAGSNRIIGREERIEYRDE
AGNLLEPKEVARLQAEGKVSLQTKYQTQTRVIDASGNQIIKNSEHAPPHPDVEGQNPETN
RNGEESVARNEPASVAGLEKSVYDEQVASAAKPASEAQGATK
Download sequence
Identical sequences A0A093VBH8 B6QTD7
Pmar_ATCC_18224:PMAA_003660.t1 XP_002152515.1.75516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]