SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093X8P9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093X8P9
Domain Number 1 Region: 61-325
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.62e-87
Family Capz alpha-1 subunit 0.0000035
Further Details:      
 
Domain Number 2 Region: 327-405
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.01e-27
Family Cytochrome b5 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093X8P9
Sequence length 458
Comment (tr|A0A093X8P9|A0A093X8P9_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFX89028.1} KW=Complete proteome; Reference proteome OX=1391699 OS=Pseudogymnoascus sp. VKM F-3808. GN=O988_08797 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MTDGFTAAAARPEVFSTLATPPQPTFPRPDSSSTHHHRRRSSSSTRARRPLKESKDEDEM
ASQLETVSAFVEGAPPGELGDVIADIKALTVESPELISQLGPAFEKYNEEQFATVKLPGG
SQQVIVSSHNSLGDGRYFDVENSSSFEFDHTTQKASNVQSYVLESANSDLIKSLIKSLAK
HAEDHYPNSSYGVYPIENDSKIAILLVANKYSPNNFWNGRWRSLYILSPSSSSSSLVGSI
KVDVHYYEDGNVRLLTTKPVSLSVSSNAATSIVREIAVAEKKYQENLNKGFTSLSEGAFK
GLRRQLPVTRQKVEWDKIAGYRHGRGIKFTFAEVAKHNTKKDIFLVIHDKVYDTTGFVDE
HPGGEEVLLDVAGQDASEAFEDVGHSDEAREILKGIEVGTLKRMPGDPAPKAQPSTTTVQ
APATGMGSVALYFILVTGGAAAFVAYKYLQAASDASKQ
Download sequence
Identical sequences A0A093X8P9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]