SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093XWH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093XWH9
Domain Number 1 Region: 79-115
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.000000144
Family Preprotein translocase SecE subunit 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093XWH9
Sequence length 118
Comment (tr|A0A093XWH9|A0A093XWH9_TALMA) Uncharacterized protein {ECO:0000313|EMBL:KFX49608.1} KW=Complete proteome; Reference proteome OX=1077442 OS=Talaromyces marneffei PM1. GN=GQ26_0092090 OC=Eurotiomycetidae; Eurotiales; Trichocomaceae; Talaromyces.
Sequence
MSDTFQELADIPKVHLPSCSHAPLPTPTSSAMACNSSTAAPSVSLTLFTSLPKYLAAEIR
NSPLDIVFLGIDGLTTSAADKREFLKISQAVGVGFVIMGAIGYFVKLIHIPVNNVLVG
Download sequence
Identical sequences A0A093XWH9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]