SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093ZPQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093ZPQ5
Domain Number 1 Region: 69-130
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 7.85e-16
Family VPS23 C-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093ZPQ5
Sequence length 145
Comment (tr|A0A093ZPQ5|A0A093ZPQ5_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY19311.1} KW=Complete proteome; Reference proteome OX=1420906 OS=Pseudogymnoascus sp. VKM F-4281 (FW-2241). GN=V493_08022 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
HSLSAQHSAMLTALHALQSETAQLEALEGALLSNSASLNSSLASADALIKRAPQMTPPSI
DDLLVAPTVVANQLYEAVAEERALGDTIFVLGRAVEKGRVAPQTFVKVTRGLAREWWLKK
VLVRKCARGLGLDDGSGWGRETGRA
Download sequence
Identical sequences A0A093ZPQ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]