SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A094A371 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094A371
Domain Number 1 Region: 570-812
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.62e-77
Family Capz alpha-1 subunit 0.00000563
Further Details:      
 
Domain Number 2 Region: 298-422
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000234
Family Pleckstrin-homology domain (PH domain) 0.0091
Further Details:      
 
Domain Number 3 Region: 41-274
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000445
Family FCH domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094A371
Sequence length 821
Comment (tr|A0A094A371|A0A094A371_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY21728.1} KW=Complete proteome; Reference proteome OX=1420906 OS=Pseudogymnoascus sp. VKM F-4281 (FW-2241). GN=V493_07167 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MATEKAAVPTQLPTRQSTGASALSDVAVSETNTRETSALLEERLRAWKHAVGYLEEYISA
TEKAQKAHAKEYERVLKSIQDPLKEGSHFDQSLGGIAGLFENMRVNTESLANSHLETEKN
LKGTVLPILERLHKEIKNKSKEISTGVGKAAKEIEKSRNTTQKHIELLGQQSAAAESSGG
KVHSHDDPYITQRGIYFRLHKQILEENNNRQDLISVQENFAAFEHHVVEVIQQAMASFVQ
YVGGQVQRNQNAYTDMLSNVQRIPPDFEWNGFKQREADVLVDPSSAPRSIDSATFPNQNH
KSTQPLLEGTLERKSRNILSSGYSTGYYAITNALYLHGFKDNDNVRKDPEPEISIYLPDA
VIGVPNGEKFHVKGKDVSKGFSSKLAGSSELNFKAHTPDDAEKWVEVIKMAAGANASRAP
YSSGPSSPISPTTQKQASFGSIGAGASAASAADAKAVEAQQEEGVTTAHPAPLKTEGGVM
GETTVASPTAVSPSATGASYRDDGWLHRRATSQARGLQHARDRTRTYIPAPRQQPSPPPH
TSAAPIEGVGRRNGFAAGDGVGVCGRRAAWRDIKALTVESPELISQLGPAFEKYNEEQFA
TVKLPGGSQQVIVSSHNSLGDGRYFDVENSSSFEFDHSTQKASNVQSYVLESANSDLIKS
LIKSLAKHAEDHYPNSSYGVYPIEDDSKIAILLVANKYSPNNFWNGRWRSLYILTPSSSS
SSLVGSIKVDVHYYEDGNVRLLTTKPLSLSVSSSAATSIVRDIAVAEKKYQENLNRGFTS
LSEGAFKGLRRQLPVTRQKVEWDKIAGYRHGRGIAKSAEGF
Download sequence
Identical sequences A0A094A371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]