SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094B8N4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094B8N4
Domain Number 1 Region: 63-207
Classification Level Classification E-value
Superfamily Actin-crosslinking proteins 4.71e-18
Family Fascin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094B8N4
Sequence length 271
Comment (tr|A0A094B8N4|A0A094B8N4_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY31710.1} KW=Complete proteome; Reference proteome OX=1420906 OS=Pseudogymnoascus sp. VKM F-4281 (FW-2241). GN=V493_00864 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MVKALSFKGDPKTKKRKRVDTASKFGEASTELTEGATGPVVEDTPASDDSWVSAEATTDI
EGPIVFVLPSEPPTCIACDTNGQVFASPLENIIDGDPGTAEPHDVRQVWVASRVAGTENF
SFKGHHGRYLSCDKFGILTAQTEAVSPLESFVAFPTASTPETFQIQNIRDKYITIAPPTK
NSAVPQLRGDAVDVSFNTTLRIRMQARFKPRLKRGKEDKAKEKISRKELEEAVGRKLEDD
EVRKLKRARREGNYHEALLDVKVKSKHDKYS
Download sequence
Identical sequences A0A094B8N4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]