SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A094DYB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094DYB4
Domain Number 1 Region: 12-277
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.14e-80
Family Capz beta-1 subunit 0.000000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A094DYB4
Sequence length 280
Comment (tr|A0A094DYB4|A0A094DYB4_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY71284.1} KW=Complete proteome; Reference proteome OX=1420912 OS=Pseudogymnoascus sp. VKM F-103. GN=V499_08502 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
HLQPRTNTHPPSDLLRRLDPKHTSTHLNSLIDLVPDLTEDLLSSVDQPLSTRWCSKTKRD
YLVCDYNRDGDSYRSPWSGEFEPALEQSSEGGVDEGAGAGAVPSDRVRKMEIRANEAFDV
YRELYYEGGLSSVYFWNLDDGFAGVVLLKKGSPQNSGSEGSWDSIHVFEAIDRARTAHYK
LTSTVILHLSTGTDALGDMDLSGNMTRQIEADLTVDDDGSHISNIGKLVEDMELKMRNLL
QEVYFGKAKDVVGDLRSVQSLAEANKEKNAHREMIDSMKR
Download sequence
Identical sequences A0A094DYB4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]