SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A094F2J0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094F2J0
Domain Number 1 Region: 241-434,466-677
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.54e-69
Family LacY-like proton/sugar symporter 0.0096
Further Details:      
 
Domain Number 2 Region: 1132-1317
Classification Level Classification E-value
Superfamily MIR domain 4.84e-60
Family MIR domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094F2J0
Sequence length 1539
Comment (tr|A0A094F2J0|A0A094F2J0_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY53607.1} KW=Complete proteome; Reference proteome OX=1420909 OS=Pseudogymnoascus sp. VKM F-4515 (FW-2607). GN=V496_07435 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MNLPPSSIYYSDLLTDDNLPSDPFILRSCTVVHPIRPPHHHPNELVTGIVHRLHAVFLLG
TYPPGGAAAISSTTFTIPSSSSTRRPANIPLRNLPSAATRSQEQFQSASLLSDDEKQSGF
SASPRSESAGSEFSDWSDTGDLGEQGTGEDDPLRRQLGEFDNNTGRHTGRRNRGDRRVRY
RLDAEHEDKKHHRGFVKEDIEIPTPPPRKISRAEQALATMMAGGERQMHGLTGKPLVYFT
SVFVSLGVFLFGYDQGVMSGIITGPIFLDYFHKPNAAEIGTMVAILEVGAFISSLVVGRL
GDIIGRRRTILYGSLIFFVGGALQTFATSMILMMLGRIIAGVGVGMLSTIVPVYQSEISP
PHNRGKLACIEFSGNIIGYATSVWVDYFCSFIDNDYSWRVPLSMQCVMGGLLAIGSLLIV
ESPRWLLDNDHDEEGMVVIANLYGEGDIHNDKAREEFREIKMNVLIQRQEGERSYLEMFK
RYRARVFIAMSAQALAQLNGINVISYYAPLVFISAGWVGRQAILMTGINGITYFLSTIPP
WYLVDRLGRRPILLSGAIMMAISLSAIAYFLHLDIKATPTLVVVFVMIYNAAFGFSWGPI
PWLYPPEILPLSIRSKGASLSTATNWFFNFIVGEITPILQETIGWRLYLMHAFFCVTSFV
VVYFIYPETRGVRLEDMNLLFGDATSAMPTPATRAETGSLMGRGSPVPSMDLRRGVGTTS
VENGLGPSMAIPGLDIDPPTVDIRDGIPRYSVDRSRGEGVGGWISRMVGGAANGGASSRG
GANSKYKPLDQDEDMASRNAVVASGIEQDGQAARRRAAPGGSAVSGSSQGLEEVDDKKRQ
PVKSSPSFLQTLDEWEFIIAPLIFTALAFFTRLYKIGLSPIVTWDEAHFGKFGSHYLKRE
FYFDVHPPLGKMLVGLSGYLAGYNGSFEFKSGERYPEELNYTFMRAFNAFFGAVCIPLAY
YTARELNFKRPAVWFVTLMVLCENSYTTISRFILLDSMLLCFTFTTVLCWARFHRLQDQS
FSLEWFTWLGLTGLSIGCVCSVKWVGLFGTALVGLYTIEDLWNKFGNYKMPKVELAAHVV
SRVAGLIVLPFIIYMLSFAAHFTILENSGPGDAQMSSLFQANLRGTEVGKDSPLEIAYGS
RATIKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDSNNEWFFYPNRAEPEFDAEAPPK
FVAHGDVLRLIHAQTGRNLHSHDVSAPITKVDKEVSCYGNTTVGDEKDHFTIEVVKDVSS
NDKSKIRTLTTAFRLKHTSLGCYLRAGNVNLPQWGFKQIEVTCTKANNPKDTFTHWNVEA
HWNGKLPAADANAYKSPFFQDFIHLNVAMATSNNALVPDPDKQDDLASQFWQWPILNVGL
RMCGWDDSIVKYFLLGNPLVYWGSTASLGVLGLIVLWYLIRWQRGYVDLKQSEIDQIHYA
GIYPVIGWFLHYFPFVAMARVTYVHHYYPALYFAILTFGFCADWFLRKRAKAVQFAVYGV
LYSAVIGLYILFMPISWGMVGPNREYRYLKWFEKWRVTD
Download sequence
Identical sequences A0A094F2J0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]