SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A094F7P5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094F7P5
Domain Number 1 Region: 56-320
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.58e-87
Family Capz alpha-1 subunit 0.00000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094F7P5
Sequence length 329
Comment (tr|A0A094F7P5|A0A094F7P5_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY55442.1} KW=Complete proteome; Reference proteome OX=1420909 OS=Pseudogymnoascus sp. VKM F-4515 (FW-2607). GN=V496_07004 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MTDGFTAEHPARPEVFSTLATLHEPAFPRPDSNNHKALHQRTRARRLLKESEEEMASQLE
TVSAFVEGAPPGELGDVIADIKALTVESPELISQLGPAFEKYNEEQFATVKLPGGSQQVI
VSSHNSLGDGRYFDVENSSSFEFDHSTQKASNVQSYVLESSNSDLIKSLIKSLAKHAEDH
YPNSSYGVYPIEDDSKIAILLVANKYSPNNFWNGRWRSLYILSSSSSSSSLVGSIKVDVH
YYEDGNVRLLTTKPVSLSVSSSAATSIVREIAVAEKKYQENLNKGFTSLSEGAFKGLRRQ
LPVTRQKVEWDKIAGYRHGRGIAKSTEGF
Download sequence
Identical sequences A0A094ETC0 A0A094F7P5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]