SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A094H5N9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094H5N9
Domain Number 1 Region: 584-848
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.88e-85
Family Capz alpha-1 subunit 0.00000361
Further Details:      
 
Domain Number 2 Region: 62-295
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000157
Family FCH domain 0.042
Further Details:      
 
Domain Number 3 Region: 321-443
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000174
Family Pleckstrin-homology domain (PH domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A094H5N9
Sequence length 857
Comment (tr|A0A094H5N9|A0A094H5N9_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFZ03696.1} KW=Complete proteome; Reference proteome OX=1420915 OS=Pseudogymnoascus sp. VKM F-4520 (FW-2644). GN=V502_10737 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MSLPVRTLTKTLHKSPTDMASHPAEKAPVPTQLPTRQSTGASALSDVAVPGTDIRETSAL
LEERLRAWKHAVGYLEEYISATEKAQKAHAKEYEKVLKSIQDPLKEGSHFDQSLGGIAGL
FENMRVNTESLANSHLETEKNLKGTVLPILERLHKEIKNKSKEISSGVGKAAKEIEKSRN
TTQKHIELLGQQSAAAESSGSKVNSHDDPYITQRGIYYRLHKQILEENNNRHDLISVQEN
FATFEHHVVEVIQQAMASFVQYVGGQAQRNQNAYTDMLSNVQRIPPDFEWNGFKQRQADV
LVDPSSAPRSIEGVTFPNQNHKSTQPLLEGTLERKSRNILSSGYSTGYYAITNALYLHGF
KDNDNVRKDPEPEISIYLPDAVVGVPNGEKFHVKGKDVSKGFSSKLAGSSELNFKAHTPD
DAEKWVEVIKMAAGANASRAPYSSGPSSPISPTTQKQASFGSIGAGASAAEAKAIEAKQE
DGVTTAHPTPLQIEQGVTGGKTVASPTAVSPSATGAVVGTDKKPPFDPIVMTDGFTAEQP
ARPEVFSTLATAHEPPFPRPDSNNLLHHRTRARRPLKASEEEMASQLETVSAFVEGAPPG
ELGDVIADIKALTVESPELISQLGPAFEKYNEEQFATVKLPGGSQQVIVSSHNSLGDGRY
FDVESSTSFEFDHSTQKASNAQSYVLESANSDLIKSLIKSLAKHAEDHYPNSSYGVYPIE
DDSKIAILLVANKYSPNNFWNGRWRSLYILSPSSSSSSLVGSIKVDVHYYEDGNVRLLTT
KPVSLSVSSSAATTIVREIAVAEKKYQENLNKGFTSLSEGAFKGLRRQLPVTRQKVEWDK
IAGYRHGRGIAKSTEGF
Download sequence
Identical sequences A0A094H5N9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]