SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A094HCX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094HCX0
Domain Number 1 Region: 347-548
Classification Level Classification E-value
Superfamily MIR domain 1.03e-57
Family MIR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094HCX0
Sequence length 961
Comment (tr|A0A094HCX0|A0A094HCX0_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFZ06161.1} KW=Complete proteome; Reference proteome OX=1420914 OS=Pseudogymnoascus sp. VKM F-4519 (FW-2642). GN=V501_07659 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MAKSKNARSSPSAVPASEGAPLLPVPTQVQVPVPVVATVKKGAIKRNDYTSDGVKDNDVF
NLPGSDYRVMIFVTVIAAIVRLFRIYQPSSVVFDEVHFGGFASKYMKGKFFMDVHPPLAK
LLLTLAGFMAGFDGNFDFKEIGKDYIEPGVPYVAMRMLPAICGILLVPTMFLTLKAAGCR
TMTAGLGAGLIIFENGLLTQARLILLDSPLMIMTAITALAFTSFTNQQEQGPAKAFQPSW
WFWLAMTGLGLGATASVKWVGLFTIAWVGSLTVVQLWVVLGDYKNVTPRLLFKHILARVF
CLILIPVTFYMAMFAIHFQILQNPGEGDGFMSSEFQATLNSKGMKDVPVDVALGSRVSIR
HHNTQGGYLHSHNLMYPGGSKQQQITLYPHKDENNVWLLENTTQPLDVNGENINGSYAWD
TISPPAFLKDNDVIKLFHIPTNRRLHSHDVRPPVTEADWQNEVSAYGYEGFEGDANDFFR
IEIVKTKSEGDLAKERVRTIQTKFRLIHVMTGCALFSHKVKLPDWASEQQEVTCAKQGTL
PNSIWFIEQNEHPQLGADAEKVNYKNPGFLGKFWELQKVMWQTNAGLVESHAWDSRPMSW
PILQRGINFWGKDHRQIYLIGNPIIWWSSTLGVAIFALFQGIAVLRWQRGYKDFNNSTFK
RFSYEIGTSILGWAFHYFPFYLMQRQLFLHHYFPALYFAVMALCQTYDHITNRIPGIGLR
ENPIIGKLGAVVFLGLSMVAFGLYSPLAYGNPWTQSACKQVKLFSKWDWDCNTFHTTYDQ
YNVKQVQSPVANVAPTSAPAPPAAIPEAKVEEQAQKPIVEQEQPVMSVAPVYSEAPILSG
SQSVVSREERVEYRDQDGNLLDAEQVKALSGKVSFQTRYETRTRIVDASGVVIEQGEASV
APPHPDVDNVDPETVAVPEKEAEAAPASQSKAEEDLVKEAAIENAKKGEAKPASDVQEAT
V
Download sequence
Identical sequences A0A094HCX0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]