SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A094HZE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094HZE8
Domain Number 1 Region: 62-326
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.32e-87
Family Capz alpha-1 subunit 0.00000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A094HZE8
Sequence length 335
Comment (tr|A0A094HZE8|A0A094HZE8_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFZ13611.1} KW=Complete proteome; Reference proteome OX=1420914 OS=Pseudogymnoascus sp. VKM F-4519 (FW-2642). GN=V501_03627 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MTTILTAEHPARPTVFSTLATSSPSPPFPRPDSNHARPHLHHHRSTRRRARCPLQASEEE
MASQLETVSAFVEGAPPGELGDVIADIKALTVESPELIGQLGPAFEKYNEEQFATVKLPG
GSQQVIVSSHNSLGDGRYFDVENSSSFEFDHSTQKASNVQSYVLESANSDLIKSLIKSLA
KHAEDHYPNSSYGVYPIEDDSKIAILLVANKYSPNNFWNGRWRSLYILSPSSSSSSLVGS
IKVDVHYYEDGNVRLLTTKPVSLSVSSSTATSIVREIAVAEKKYQENLNKGFTSLSEGAF
KGLRRQLPVTRQKVEWDKIAGYRHGRGIAKSAEGF
Download sequence
Identical sequences A0A094HZE8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]