SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094JVX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094JVX2
Domain Number 1 Region: 6-124
Classification Level Classification E-value
Superfamily HSP20-like chaperones 2.88e-30
Family Co-chaperone p23-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A094JVX2
Sequence length 228
Comment (tr|A0A094JVX2|A0A094JVX2_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFZ13253.1} KW=Complete proteome; Reference proteome OX=1420914 OS=Pseudogymnoascus sp. VKM F-4519 (FW-2642). GN=V501_03777 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MSTTTVTPEVLWAQRSNATEPEKNYIYLTISVPDCKEEDLKLDLKPTGLTFSGKSDSLKK
SYHVELELFAEIDVDNSKINHTSKNIELVLRKKEAKEEFWPRLLKDSKKVHYLKTDFDKW
VDEDEQEEAPEEDLGGMGGMPQGGMGGMGGAGGMGGMDMASMMGGMGGAGGDFGGIDFSK
LGAMGGMGGMGGMGDMDDEGEDDDELPALEEQEGGDKAKSSDKIEEIN
Download sequence
Identical sequences A0A094JVX2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]