SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094KLX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094KLX2
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-43
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A094KLX2
Sequence length 121
Comment (tr|A0A094KLX2|A0A094KLX2_9AVES) Tyrosine-protein phosphatase non-receptor type 6 {ECO:0000313|EMBL:KFZ60238.1} KW=Complete proteome; Reference proteome OX=345573 OS=Podiceps cristatus (great crested grebe). GN=N338_03167 OC=Podiceps.
Sequence
RLVKHYQYFSWPDHGVPNEPGGVLSFLDQVNRAQRSIPDTGPIIVHCSAGIGRTGTIIVI
DILVDIIHRQGLDCDIDIPKTIQMVRRQRSGMVQTEAQYKFVYMAVQQYIEAEQKRLEEE
Q
Download sequence
Identical sequences A0A087QSB6 A0A087VBZ4 A0A091H7Z5 A0A091KFL2 A0A091L7F7 A0A091PS21 A0A091PTJ1 A0A091S4G9 A0A091TZ84 A0A091USY4 A0A091WLC5 A0A093ESU6 A0A093FPS8 A0A093J2V1 A0A093JL64 A0A093QZZ6 A0A094KLX2 A0A099Z9A5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]