SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094KS16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094KS16
Domain Number 1 Region: 2-274
Classification Level Classification E-value
Superfamily BEACH domain 1.44e-120
Family BEACH domain 0.0000000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094KS16
Sequence length 274
Comment (tr|A0A094KS16|A0A094KS16_ANTCR) Neurobeachin-like 1 {ECO:0000313|EMBL:KFZ53443.1} KW=Complete proteome; Reference proteome OX=279965 OS=carolinensis). GN=N321_03293 OC=Antrostomus.
Sequence
VLQKWVNREISNFDYLIQLNTMAGRTYNDLAQYPVFPWILQDYTSEDLDLNNPAVFRDLS
KPIGVVNEKNAKAVKEKYDNFEDPLGMIDKFHYGTHYSNAAGVMHYLIRVEPFTTLHIQL
QSGRFDCADRQFHSIPATWQALMDNPNDVKELIPEFFYFPEFLENQNGFNLGQLQISKEV
VNDVVLPKWAHSPEDFIYKHRRALESEYVSAHLHEWIDLIFGYKQRGPAAVEALNVFYYC
TYEGAVDLDALTDEKERKALEGMINNFGQTPCQL
Download sequence
Identical sequences A0A094KS16

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]