SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094L0R6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094L0R6
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 2.36e-20
Family Interleukin 8-like chemokines 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A094L0R6
Sequence length 71
Comment (tr|A0A094L0R6|A0A094L0R6_ANTCR) C-C motif chemokine {ECO:0000256|RuleBase:RU361150} KW=Complete proteome; Reference proteome OX=279965 OS=carolinensis). GN=N321_10986 OC=Antrostomus.
Sequence
APYSPSECCFGYMKSSRRLTNLKHFYTTPKDCFLPAVVFETRNGRKICADPEISWVQKAV
QKLQKMKELPA
Download sequence
Identical sequences A0A094L0R6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]