SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094L2W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094L2W9
Domain Number 1 Region: 2-186
Classification Level Classification E-value
Superfamily ITPase-like 3.34e-58
Family Maf-like 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A094L2W9
Sequence length 199
Comment (tr|A0A094L2W9|A0A094L2W9_9GAMM) Maf-like protein IDAT_04795 {ECO:0000256|HAMAP-Rule:MF_00528} KW=Complete proteome; Reference proteome OX=1517416 OS=Idiomarina atlantica. GN=IDAT_04795 OC=Idiomarinaceae; Idiomarina.
Sequence
MELVLASGSPRRFELLQLLDRPFRVVHPDIIEQQHPHERPLDYVERLAREKAEAGAQLCA
SEGLTNAAVIGADTVVVCADQVLEKPRNEADYKQMMELLSGRAHQAITAVALHHNGATTS
KVVSTTVYFKHLNAAEIAAYWQSGEPKDKAGGYGIQGRAGKFVTHIEGSYLAVVGLPLYE
TEQLIVQVEAAVAKDNYER
Download sequence
Identical sequences A0A094L2W9
WP_034731249.1.52930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]