SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094L6T6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094L6T6
Domain Number 1 Region: 2-68
Classification Level Classification E-value
Superfamily XseB-like 7.85e-20
Family XseB-like 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094L6T6
Sequence length 81
Comment (tr|A0A094L6T6|A0A094L6T6_9GAMM) Exodeoxyribonuclease VII small subunit {ECO:0000256|HAMAP-Rule:MF_00337} KW=Complete proteome; Reference proteome OX=435908 OS=Idiomarina salinarum. GN=IDSA_10350 OC=Idiomarinaceae; Idiomarina.
Sequence
MADLTFEQAMQQLEEIVVQLEQGELPLEQALEKFEKAVSLSRISQNKLQQAEQKVSKLLQ
QQGEEALVPFDNQVDAQEDNA
Download sequence
Identical sequences A0A094L6T6
WP_034776403.1.32996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]