SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094M269 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094M269
Domain Number 1 Region: 50-178
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.88e-45
Family Regulator of G-protein signaling, RGS 0.00000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094M269
Sequence length 180
Comment (tr|A0A094M269|A0A094M269_9AVES) Regulator of G-protein signaling 16 {ECO:0000313|EMBL:KFZ69519.1} KW=Complete proteome; Reference proteome OX=345573 OS=Podiceps cristatus (great crested grebe). GN=N338_08316 OC=Podiceps.
Sequence
MCWGLATLPITCLERAKDLKTRLGILLHKPELGQRIGTSSKLQLGSRRRDSSREVLEWRE
SFDQLLKSKSGVTAFHTFLKTEFSEENLDFWLACEDFKKTRSKTKLASKANRIFEEFVQS
EAPREVNIDHETREITRKNLSGATSTCFNEAQAKTRTLMEKDSYPRFLKSASYQDMTKQA
Download sequence
Identical sequences A0A094M269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]