SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094MKB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A094MKB0
Domain Number - Region: 38-82
Classification Level Classification E-value
Superfamily SP0830-like 0.017
Family SP0830-like 0.046
Further Details:      
 
Domain Number - Region: 131-217
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0238
Family Intein endonuclease 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094MKB0
Sequence length 329
Comment (tr|A0A094MKB0|A0A094MKB0_9PSEU) Putative sporulation transcription regulator WhiA {ECO:0000256|HAMAP-Rule:MF_01420, ECO:0000256|SAAS:SAAS00981672} KW=Complete proteome OX=1427749 OS=Amycolatopsis sp. MJM2582. GN=ED92_29920 OC=Amycolatopsis.
Sequence
MAMTAAVKDELSRLEITKIGPRRAEVASMLRFAGGLHIVAGRVVVEAELDTGSVARRLRK
EIHELYGHQSDVHVISSSGLRKGTRYVVRVVKDGEGLARQTGLIDQRGRPVRGLPAAVVS
GGVADAEAAWRGAFLAHGSLTEPGRSSSLEVTCPGPEAALALVGAARRMGIQAKSREVRG
ADRVVVRDGDAIGALLTRLGAHTSVLAWEERRMRREVRATANRLANFDDANLRRSARAAV
AAAARVERALDILGESAPEHLLAAGKLRLSNRQASLEELGQLSDPQMTKDAVAGRIRRLL
AMADKKAKEQGIPDTESAVTPDMLEEDEA
Download sequence
Identical sequences A0A075UZK6 A0A094MKB0 M2P1N9 M2YJP7 R4T3W6
WP_005152315.1.12369 WP_005152315.1.13628 WP_005152315.1.1574 WP_005152315.1.43116 WP_005152315.1.61622 WP_005152315.1.61724 WP_005152315.1.62950 WP_005152315.1.6660 gi|506931323|ref|YP_008011761.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]