SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094N760 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094N760
Domain Number 1 Region: 103-173
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000126
Family VWC domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094N760
Sequence length 174
Comment (tr|A0A094N760|A0A094N760_9AVES) von Willebrand factor C domain-containing protein 2-like {ECO:0000313|EMBL:KFZ62461.1} KW=Complete proteome; Reference proteome OX=345573 OS=Podiceps cristatus (great crested grebe). GN=N338_10471 OC=Podiceps.
Sequence
MALHIHEAWILLFVIPALVTPAAINHEDYPADEGDQTSSNDNLIFDDYRGKGCVDDSGFV
YKLGERFFPGHSNCPCVCTEDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHG
KNYKILEEFKPSPCEWCRCEPSNEVHCVVADCAVPECVNPVYEPEQCCPVCKNG
Download sequence
Identical sequences A0A091L4C6 A0A091Q080 A0A091TTT9 A0A093ELC2 A0A094N760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]