SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094PXE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094PXE2
Domain Number 1 Region: 1-37
Classification Level Classification E-value
Superfamily Ribosomal protein L36 5.1e-17
Family Ribosomal protein L36 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094PXE2
Sequence length 37
Comment (tr|A0A094PXE2|A0A094PXE2_9ACTN) 50S ribosomal protein L36 {ECO:0000256|HAMAP-Rule:MF_00251, ECO:0000256|RuleBase:RU000571} KW=Complete proteome; Reference proteome OX=1504316 OS=actinobacterium acMicro-1. GN=GM42_2975 OC=Bacteria; Actinobacteria.
Sequence
MKVNPSVKKICDKCKVIRRHGNVMVICENPRHKQRQG
Download sequence
Identical sequences A0A094PXE2 A0A0Q6VIL9 A0A0Q8WHH0 A0A239FL59 I0R290
WP_007540807.1.2547 WP_007540807.1.30558 WP_007540807.1.68222 WP_007540807.1.78031 WP_007540807.1.8204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]