SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094QXN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094QXN1
Domain Number 1 Region: 50-102
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.0000208
Family Ribosomal protein S13 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094QXN1
Sequence length 107
Comment (tr|A0A094QXN1|A0A094QXN1_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:KGA19231.1} OX=449393 OS=freshwater metagenome. GN=GM51_6960 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MAVPVLTNEQRIAASAKAVEVRTKRAALRRQLKESKVTFTEVLSVADSDDIVSGMRVVTI
LESLPGIGKIKASALMETCDIALSRRMKGLGSTQAQKLKAALNGRAS
Download sequence
Identical sequences A0A094QXN1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]