SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094ZP58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094ZP58
Domain Number 1 Region: 74-167
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 7.98e-33
Family VPS28 C-terminal domain-like 0.00036
Further Details:      
 
Domain Number 2 Region: 3-66
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 5.56e-18
Family VPS28 N-terminal domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094ZP58
Sequence length 171
Comment (tr|A0A094ZP58|A0A094ZP58_SCHHA) Vacuolar protein sorting-associated protein 28-like protein {ECO:0000313|EMBL:KGB36495.1} KW=Complete proteome; Reference proteome OX=6185 OS=Schistosoma haematobium (Blood fluke). GN=MS3_04788 OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
EVKLYRTAREREKYTAACSKLLVQYKAAFKQVQGDEFATVEDFMRKYKMDCPAALERIKE
GRPITIKDDKQNINKSIADTVSLFITIMDKLRLDIRAVDELHPDLRELYETLYRLSILPA
DFEGKDRVKAWLDKMDQMQASDELSEAEVRQMLFDLDSGYNAFNRTLHSGQ
Download sequence
Identical sequences A0A094ZP58
XP_012796258.1.65645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]