SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095BAJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095BAJ6
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.22e-28
Family Ribosomal L11/L12e N-terminal domain 0.0000356
Further Details:      
 
Domain Number 2 Region: 68-140
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 4.19e-24
Family Ribosomal protein L11, C-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A095BAJ6
Sequence length 143
Comment (tr|A0A095BAJ6|A0A095BAJ6_9SPHN) 50S ribosomal protein L11 {ECO:0000256|HAMAP-Rule:MF_00736, ECO:0000256|SAAS:SAAS00731162} KW=Complete proteome; Reference proteome OX=1120705 OS=Sphingopyxis sp. LC363. GN=FG95_00743 OC=Sphingomonadaceae; Sphingopyxis.
Sequence
MAKKISGYIKLQVPAGTANPSPPLGPALGQRGVNIMEFCKAFNAATDGMDKGTPTPTIIT
VYADKSFSFVTKTPPATYLIKKAANLKSGSKEPGKISGGKIARSKLAEIAEIKMKDLNAN
DLEQATKIIEGSARSMGLEVTEG
Download sequence
Identical sequences A0A095BAJ6
WP_037554038.1.57869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]