SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A095BV72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095BV72
Domain Number 1 Region: 173-197,229-390
Classification Level Classification E-value
Superfamily MIR domain 1.27e-26
Family MIR domain 0.0037
Further Details:      
 
Domain Number 2 Region: 1094-1216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-19
Family SPRY domain 0.026
Further Details:      
 
Domain Number 3 Region: 110-225,263-282
Classification Level Classification E-value
Superfamily MIR domain 0.0000000000915
Family MIR domain 0.0082
Further Details:      
 
Domain Number 4 Region: 670-813
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000435
Family Galectin (animal S-lectin) 0.069
Further Details:      
 
Domain Number 5 Region: 441-542
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000000405
Family IP3 receptor type 1 binding core, domain 2 0.013
Further Details:      
 
Domain Number 6 Region: 54-137
Classification Level Classification E-value
Superfamily MIR domain 0.0000000536
Family MIR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A095BV72
Sequence length 1443
Comment (tr|A0A095BV72|A0A095BV72_SCHHA) Ryanodine receptor 44F {ECO:0000313|EMBL:KGB32838.1} KW=Complete proteome; Reference proteome OX=6185 OS=Schistosoma haematobium (Blood fluke). GN=MS3_00971 OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MCSLEIISRESPPPNMPPCVFVLDQALSVRALQEMLSIQHQSSDGSGQSGHRTLLYGHAI
RLKHRESNMYLSCLSTSTSQDKLAFDVGLQQNAETEACWWTIHPASKQRSVGEKVRIGDD
LILVSVSSERYLHVYGEVISSNGVIASFQQTLWTVLPVSSGAIRQKSMHMVLGGDVVRLF
HGDESLTAACATESEEFSSSVAMTMNGSAPGSPPNKIQRSSIVNSDLLSGSRHAVMYEIG
AVSTSARSLWRIEHKKTKWSAGFFSWGSEIRLRHVTTGRYLGVLPSEANGSGHCDVVTLS
AHEATNAASIFLIRPSKDDKKRSEEHETEGMGEPDLRLGETLAYLQHAASGRWLSYEAYE
TRKRGVGRVEEKKAVLLIEGHMDDLFSLVRAQDEEIRSASAIRRCTSVFNNFIHTLNYIS
SPQNITLPSQQSQCNLSSGHLLGEVTQCLEDLIEFFAQPHPHEEHEIQQSKLTALRNRQN
LFQNEGMIGHVLSTIEKFTGTFQTRREFSQAVGEDKADQFDELGNYLYLLLAALIRGNRE
NCAQFATPTRLDWLFNRLELQQGFAEGVLDALHCVLTDSDEALYLITERHIRTLIGLLDK
QGRDPRVLQALCSLCLGRQGGAVRLNQELIYETLLPQKDLLLQTKLVDQCGSVRPNIFVG
YKDGGAMYPKWYFEVIIDSLETVTHQPAKIRVGWANTEGYNAHPCGGPGWGAAGLGDDLF
SYAFDGSCLWAGGKPKRATIGTDEATNEEATSNVPLKRGDIIGCLLDLTGPVIQFNVNGR
LVRGYFQDFNISGLFYPCMSMNAKASARFLLGSNQGRLHHGPPPGYSPIYYARQPGQKLR
LEPVFTFGQLDKYVFTGPLNSPTPQQYVFVPRTVRTSHIQLPNYVEMVRDRLAENLHEMW
SMRKIDQGWKYGERRDDENNLHPCLTTFDKLPPSDKQYNVTLAYETLRTIISLGYNITYE
PLPEGTRMRTMKLSNSFTQVNGYKPQPLDLTQIRLSVRIEALVDQLAENTHNMWARDRIA
LGWTYGFVEDHSQKRSPHLVPYSEVDPIIQQSNKDTAIETVKTLIAYGYSLEPISSDXXX
XLTFFIKKLFIFRKVAYYEAEILTSGFIRIGWAKKSAPPDLIIGSNSSSYAFAAHQARKW
NRNGSVYGTICRPGDVVGCMMDLVDKTISFSLNGELMMDPLGLEIAFKHIKVEEGYVPAF
SLGSGQQVKINYGNDVQSLKFFTYCGLQEGYKPLGVNMCRPLPMWYSREDPSLFVDVDRQ
HPSLKVNVSSGTTPTFKVTVKQADHISSEEIQFLRLSLGTQCKDHFTSKTLNERHAHLDA
LRRQLEPEPIYTQGVGVGDSSNLIMMGQDMSASTLEVRDRRGGGSLLSGGGSSLTGGKRG
GAHATTGSLGPSGGGGQGSAGSGSLLSATAGGFSTGITGPQVTTTQMSQLDQNPPGAISG
QSW
Download sequence
Identical sequences A0A095BV72
XP_012792598.1.65645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]