SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A095DH13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095DH13
Domain Number 1 Region: 346-540
Classification Level Classification E-value
Superfamily MIR domain 1.31e-59
Family MIR domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A095DH13
Sequence length 919
Comment (tr|A0A095DH13|A0A095DH13_CRYGR) Dolichyl-phosphate-mannose-protein mannosyltransferase {ECO:0000313|EMBL:KGB79961.1} KW=Complete proteome; Reference proteome OX=294750 OS=(Cryptococcus bacillisporus). GN=CNBG_5899 OC=Cryptococcus gattii species complex.
Sequence
MSQPLTRRVPLQPHPSQPSTFASKVTVESEADARLREHHAGPHTIQKTAFGGKRGSAAVG
RIGKREWTMIAGMVVVALYVRLYKLGRPSSVVFDEVHFGGFAMKYIRRKFFMDVHPPLAK
LLVTLSAWVGGFDGKFDFKDIGKDYLEPGVPYITMRFFPAALGIALIPLAFLTLLALRLS
HISALLGALLVTFDNALITQSRLILLDSFLVFFTGLTTFFWVRFSNDDSEGRAFTKPWWI
NLLCTGLSLGAVVSCKWVGLFTIAMIGVGTLRQLWLLLGNLKVTPRQYVRHFAARTLCLI
VVPFTFYMLMFKIHFWILNESGDGDGFMSSEFQHTLQGHGMADTFADVGFGSKVSIRHVN
TQGGYLHSHPHPYPGGSKQQQITLYPHRDDNNVWRIVNASAPDGPSSYPWDELPFEYVLT
GTKIRLEHVTTEKRLHSHDIRPPVSEVDFQNEVSGYGFPGFAGDANDDFIVEITKHTRGR
NDKQAKHRLKTLRSEFRLRHALSGCYLFSHKVKLPDWGYEQQEVTCNKNPTWENSLWYIE
TNQHAQLSMDAERVNYEKPSFFEKFFELNAVMWRTNAGLTERHAYDSRPQHWPWLRRGIN
FWVKDYRQVYLIGNPVVWWSSTAAIVAYVAVRGFLVLRAQRGYRDLHQPKLAFYDDICAF
CVIGWALHYFPFYLMQRQLFLHHYLPALYFAILLFCTVFDYTTSALRPKIRANIAIAILI
LALWSWNHWSSLAYAGEWTKSACENGKWLRTWDFSCNDFYESTSMYNSHAAMSSEKIAAT
DLGPDSATTTLIEDIPEPIQNVFQQDPPPEEKTIAPVGPAPVVQMEESSAVFIPEGEEAP
IVEDLRAPVGNDAGDPAVTDGEDDGGWHGGAEDGQHGQRKDEVKTKEGEAPVGATVDIPD
MGMDEEQKLLVDQIMDEQE
Download sequence
Identical sequences A0A095DH13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]