SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A095GKP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095GKP8
Domain Number 1 Region: 150-332
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.27e-60
Family Methylesterase CheB, C-terminal domain 0.0000215
Further Details:      
 
Domain Number 2 Region: 1-103
Classification Level Classification E-value
Superfamily CheY-like 2.13e-19
Family CheY-related 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A095GKP8
Sequence length 334
Comment (tr|A0A095GKP8|A0A095GKP8_BURCE) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=292 OS=Burkholderia cepacia (Pseudomonas cepacia). GN=DM42_3929 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MNIGIVNDLPLAVEAMRRAIARRPEHRVLWVATDGAQAVELCAAQPPDIVLMDLIMPKFD
GIEATRRIMRSERPCAILIVTSCIGANAWRVFEAMGAGALDAVDTPRLGDGAAGDTTKLL
LAKIDQIGRLLDAPGGPRIAGTAARNGGGPLVAIGASAGGPGALASILGSLPADFNAPIV
IVQHVDRAFAEGMAQWLDGQTRLAVRVAREGDRPQPGVALLAATDDHLRITRAGTLEYTR
EPAATPYRPSVDVFFNSLTEHWPGRVIGVLLTGMGRDGAIGLKALRMKGYHTIAQDEATS
AVYGMPKAAATLGAARAILPLGRIAGELAALARI
Download sequence
Identical sequences A0A095GKP8 A0A1V6KZF6 B4EGR7
216591.BCAM1162 gi|206563015|ref|YP_002233778.1| WP_006495190.1.10003 WP_006495190.1.100292 WP_006495190.1.100706 WP_006495190.1.100899 WP_006495190.1.101897 WP_006495190.1.10541 WP_006495190.1.10851 WP_006495190.1.11355 WP_006495190.1.11512 WP_006495190.1.1166 WP_006495190.1.12746 WP_006495190.1.12975 WP_006495190.1.13079 WP_006495190.1.1352 WP_006495190.1.13636 WP_006495190.1.14088 WP_006495190.1.15457 WP_006495190.1.15547 WP_006495190.1.16401 WP_006495190.1.16963 WP_006495190.1.18053 WP_006495190.1.19408 WP_006495190.1.19923 WP_006495190.1.19997 WP_006495190.1.21852 WP_006495190.1.22015 WP_006495190.1.22175 WP_006495190.1.22218 WP_006495190.1.22782 WP_006495190.1.24796 WP_006495190.1.25261 WP_006495190.1.25444 WP_006495190.1.25912 WP_006495190.1.27304 WP_006495190.1.27889 WP_006495190.1.27910 WP_006495190.1.28724 WP_006495190.1.29408 WP_006495190.1.2962 WP_006495190.1.31157 WP_006495190.1.31271 WP_006495190.1.31547 WP_006495190.1.32398 WP_006495190.1.33877 WP_006495190.1.34650 WP_006495190.1.34976 WP_006495190.1.35688 WP_006495190.1.36423 WP_006495190.1.37217 WP_006495190.1.37542 WP_006495190.1.38451 WP_006495190.1.38687 WP_006495190.1.39067 WP_006495190.1.39114 WP_006495190.1.39276 WP_006495190.1.39543 WP_006495190.1.40288 WP_006495190.1.40482 WP_006495190.1.42088 WP_006495190.1.43021 WP_006495190.1.43226 WP_006495190.1.43317 WP_006495190.1.43417 WP_006495190.1.44508 WP_006495190.1.45869 WP_006495190.1.46650 WP_006495190.1.46700 WP_006495190.1.46780 WP_006495190.1.46794 WP_006495190.1.46998 WP_006495190.1.48439 WP_006495190.1.48997 WP_006495190.1.49743 WP_006495190.1.4986 WP_006495190.1.50276 WP_006495190.1.50840 WP_006495190.1.51790 WP_006495190.1.51974 WP_006495190.1.52424 WP_006495190.1.52578 WP_006495190.1.52657 WP_006495190.1.52705 WP_006495190.1.54239 WP_006495190.1.55042 WP_006495190.1.55485 WP_006495190.1.55547 WP_006495190.1.56058 WP_006495190.1.57358 WP_006495190.1.57447 WP_006495190.1.57568 WP_006495190.1.5773 WP_006495190.1.59223 WP_006495190.1.59344 WP_006495190.1.59475 WP_006495190.1.60310 WP_006495190.1.60885 WP_006495190.1.6305 WP_006495190.1.63423 WP_006495190.1.63472 WP_006495190.1.6376 WP_006495190.1.64016 WP_006495190.1.64618 WP_006495190.1.64825 WP_006495190.1.66286 WP_006495190.1.66306 WP_006495190.1.66837 WP_006495190.1.67642 WP_006495190.1.6794 WP_006495190.1.68100 WP_006495190.1.68277 WP_006495190.1.69013 WP_006495190.1.69134 WP_006495190.1.7038 WP_006495190.1.70514 WP_006495190.1.70783 WP_006495190.1.71091 WP_006495190.1.71103 WP_006495190.1.71282 WP_006495190.1.71578 WP_006495190.1.71608 WP_006495190.1.71688 WP_006495190.1.72171 WP_006495190.1.7270 WP_006495190.1.7344 WP_006495190.1.73989 WP_006495190.1.74200 WP_006495190.1.75651 WP_006495190.1.75714 WP_006495190.1.75887 WP_006495190.1.77749 WP_006495190.1.77887 WP_006495190.1.78085 WP_006495190.1.783 WP_006495190.1.78542 WP_006495190.1.78834 WP_006495190.1.79353 WP_006495190.1.79411 WP_006495190.1.79438 WP_006495190.1.79921 WP_006495190.1.80961 WP_006495190.1.81932 WP_006495190.1.8203 WP_006495190.1.82124 WP_006495190.1.82360 WP_006495190.1.82669 WP_006495190.1.82703 WP_006495190.1.83171 WP_006495190.1.83220 WP_006495190.1.83617 WP_006495190.1.83765 WP_006495190.1.85154 WP_006495190.1.85579 WP_006495190.1.85676 WP_006495190.1.85744 WP_006495190.1.85815 WP_006495190.1.86231 WP_006495190.1.8632 WP_006495190.1.86513 WP_006495190.1.86925 WP_006495190.1.87490 WP_006495190.1.87716 WP_006495190.1.87780 WP_006495190.1.87798 WP_006495190.1.88184 WP_006495190.1.88381 WP_006495190.1.8869 WP_006495190.1.88916 WP_006495190.1.89316 WP_006495190.1.89494 WP_006495190.1.8972 WP_006495190.1.89769 WP_006495190.1.89848 WP_006495190.1.89939 WP_006495190.1.89946 WP_006495190.1.9013 WP_006495190.1.9034 WP_006495190.1.90806 WP_006495190.1.90836 WP_006495190.1.91074 WP_006495190.1.91929 WP_006495190.1.92028 WP_006495190.1.92582 WP_006495190.1.92898 WP_006495190.1.92934 WP_006495190.1.95357 WP_006495190.1.95626 WP_006495190.1.95790 WP_006495190.1.96852 WP_006495190.1.9698 WP_006495190.1.97307 WP_006495190.1.98001 WP_006495190.1.98120 WP_006495190.1.98227 WP_006495190.1.98417 WP_006495190.1.98528 WP_006495190.1.98819 WP_006495190.1.99008 WP_006495190.1.99341 WP_006495190.1.99710 WP_006495190.1.99910 WP_006495190.1.99967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]