SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A095HV60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095HV60
Domain Number 1 Region: 731-971
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.18e-22
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.022
Further Details:      
 
Domain Number 2 Region: 27-228
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.71e-16
Family Pyruvate oxidase and decarboxylase PP module 0.079
Further Details:      
 
Domain Number 3 Region: 441-628
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000294
Family Pyruvate oxidase and decarboxylase PP module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A095HV60
Sequence length 1192
Comment (tr|A0A095HV60|A0A095HV60_BURGA) Pyruvate ferredoxin/flavodoxin oxidoreductase family protein {ECO:0000313|EMBL:KGC17454.1} KW=Complete proteome OX=28095 OS=Burkholderia gladioli (Pseudomonas marginata) (Phytomonas marginata). GN=DM48_4496 OC=Burkholderiaceae; Burkholderia.
Sequence
MTARPPLDGTPALADYRLTDNLTATRGRVFLTGTQALVRLMLMQRERDAAHAIDSAGFVS
GYRGSPLGMVDQQMWKAKKLLDAARVRFLPAINEELGGTAVLGTQRVEADPERTVEGVFA
MWYGKGPGVDRAGDALKHGNAYGASPHGGVLVVAGDDHGCVSSSMPHQSDFSMIGWQMPV
VNPSNIADMLEFGLYGWALSRFSGAWVGFKAISETVESGSTVDLDALVTDWPEPPAFAAP
AGGLHNRWPDLPSLSIEARLAAKLDAVRHFAKHNSIDRWVAPSPRASVGIVTCGKAHLDL
MEALRRLDLTVADLDAAGVRIYKVGLSFPLETTRLERFVEGLEEVLVIEEKGPVIEQQIK
DHLYNRVEGARPRVLGKHDAQGAPLLSALGELRPSRVLPVFADWLARHRPALDRRERVVE
LIAPDILSNEADAVKRTPYFCSGCPHNTSTKVPEGSIAQAGIGCHFMASWMERDTTGLIQ
MGGEGVDWAAHAMFTNTRHVFQNLGDGTYFHSGILAIRQAVAARATLTYKILYNDAVAMT
GGQPVDGSLSVPQIARQVEAEGVSRFVVVSDEPEKYDGHRDQFPRGTTFHHRDELDAVQR
ELRDTDGVTVLIYDQTCAAEKRRRRKKGECPDPARRAFINEAVCEGCGDCGVQSNCLSVE
PVETPLGRKRRIDQSSCNKDYSCVNGFCPSFVTVEGAALKKAAGIAFDEAALAASVEALP
LPAARLDAAPYDMLVTGVGGTGVVTVGALISMAAHLEGKSASVLDFMGFAQKGGSVLSYV
RIAARDEWLNQVRIDTQQADVLLACDMVVGASAEALQTVRHARTRIVVNTHRIPNAAFVR
DPDASLHAEALLDKMRHAAGEDFVSDCDAQALVARFLGDSIGANILMLGFAWQLGRVPVS
LDALMRAIELNGVAVAANRLAFAIGRMAAADPAGLDALWNARHPLPQVVAPRTLDELVED
RAGRLDAYGGRRYVERYRALVGAARATGDERVAEAVATTFYRLLAVKDEYEVARLYSDGS
FRAALAAQFEGTAGSDYRLRFHMAPPTTARSRDGARPRKQSFGGWMWPVLGMLARFRALR
GSLLDPFGRTEERRMERALADDYEVTMTRAFAALQSRSAEVAEAVAALAALPARVRGYGP
VKLASVAAMKRAERPLALAAGVEASTSAAVAHAIESIKGGGALRGIPVVVAK
Download sequence
Identical sequences A0A095HV60
WP_036048976.1.1979 WP_036048976.1.34339 WP_036048976.1.40080 WP_036048976.1.51104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]