SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095SDZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095SDZ7
Domain Number 1 Region: 8-83
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 2.48e-31
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.00019
Further Details:      
 
Domain Number 2 Region: 268-349
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase, C-terminal domain 1.7e-29
Family Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.0000287
Further Details:      
 
Domain Number 3 Region: 189-267
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase domain 7.85e-18
Family Methylated DNA-protein cysteine methyltransferase domain 0.0004
Further Details:      
 
Domain Number 4 Region: 88-131
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000161
Family AraC type transcriptional activator 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A095SDZ7
Sequence length 355
Comment (tr|A0A095SDZ7|A0A095SDZ7_9GAMM) Adenosine deaminase {ECO:0000313|EMBL:KGD62876.1} KW=Complete proteome OX=1177181 OS=Alcanivorax jadensis T9. GN=T9A_00196 OC=Alcanivoracaceae; Alcanivorax.
Sequence
MSTVTAQITDTQWHAIQNRDRSADGRFVYGVITTGIFCRPSCPARRPNPANVRVFPNGQE
ALQAGFRPCRRCNPFSLAGSPVTDTVTALCRHIEQSHSLPTLKELAAQCGWSRHHLQRQF
KAVTGVSPRDYGLAVRRRRLTGNLQRHASISGAMQESGMESGSQLYSQGKQMLGMLPGQY
RSGGTGTAIRFAMAECSLGSLLVAETSQGLCAISLGDAPEPLLEEFQARFAGAELLPPDP
AFDSKVARVISLVEDPKQSLSLPLDIRGTAFQQRVWQALQQIPPGTTLSYQALAETLGQP
GAARAVASACAANTLAVAIPCHRIVRRDGSLSGYRWGVERKRVLLERELENKESE
Download sequence
Identical sequences A0A095SDZ7 A0A2E7XQT4
WP_035244357.1.20877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]