SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A095SE98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095SE98
Domain Number 1 Region: 8-191
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.89e-58
Family Methylesterase CheB, C-terminal domain 0.0000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A095SE98
Sequence length 193
Comment (tr|A0A095SE98|A0A095SE98_9GAMM) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=1177181 OS=Alcanivorax jadensis T9. GN=T9A_00281 OC=Alcanivoracaceae; Alcanivorax.
Sequence
MINRIGPVKAIVMGASWGGLNAYTRILSALPADFPAAILLVQHQHASAENRLPWLLARYC
QLPVIAPEDKEEIQPGCVYVAPPGYHMLVEEDGTLAFSAGRAVLFSRPSVDELFLSAGAV
YGKQLVGVILTGANEDGAKGIDYIHRRGGFTIAQSPVSAEAPAMPEAAIKTGAVSRVLDL
EAIGPFLAEQVPG
Download sequence
Identical sequences A0A095SE98

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]