SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095SWQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095SWQ6
Domain Number 1 Region: 7-60
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.0000000000017
Family F1F0 ATP synthase subunit C 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A095SWQ6
Sequence length 62
Comment (tr|A0A095SWQ6|A0A095SWQ6_9FLAO) Lipid-binding protein {ECO:0000256|HAMAP-Rule:MF_01396} KW=Complete proteome; Reference proteome OX=1453498 OS=Flavobacterium aquatile LMG 4008 = ATCC 11947. GN=LG45_03930 OC=Flavobacteriaceae; Flavobacterium.
Sequence
MQIPEIVGAGLIVIGAGLGIGKIGGSAMDAIARQPEASGKIQTAMLIAAALIEGIGFAAL
FA
Download sequence
Identical sequences A0A095SWQ6
WP_035124574.1.77607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]