SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095UC27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095UC27
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily S13-like H2TH domain 6.67e-45
Family Ribosomal protein S13 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A095UC27
Sequence length 118
Comment (tr|A0A095UC27|A0A095UC27_9GAMM) 30S ribosomal protein S13 {ECO:0000256|HAMAP-Rule:MF_01315} KW=Complete proteome OX=1177181 OS=Alcanivorax jadensis T9. GN=T9A_02936 OC=Alcanivoracaceae; Alcanivorax.
Sequence
MARIAGVNIPENKHTVISLTYIFGIGRTRAAEICTSAGIDQTAKVRDLSGEQLDVIRGEV
AKLSTEGDLRREITMNIKRLMDLGCYRGIRHRRGLPLRGQRTKTNARTRKGPRKPIRK
Download sequence
Identical sequences A0A095UC27
WP_035249949.1.20877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]