SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A095UWR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095UWR8
Domain Number 1 Region: 158-346
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.7e-71
Family Methylesterase CheB, C-terminal domain 0.000000173
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 4.41e-28
Family CheY-related 0.00000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A095UWR8
Sequence length 352
Comment (tr|A0A095UWR8|A0A095UWR8_9BURK) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=1532557 OS=Achromobacter sp. RTa. GN=JL37_15455 OC=Alcaligenaceae; Achromobacter.
Sequence
MKKISVLCVDDSALVRGLMTEIINSQPDMEVVATAPDPLVARELIKRHNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTERGGEITLRALELGAIDFVTKPKLGIRDGLLEYT
EIIADKIRAASRAKLRAPTSHSAQAAPAPMLRRPLASSEKLVIVGASTGGTEAIREVLQP
LPPDSPAILITQHMPAGFTRSFAQRLDALCAVTVREAVHGERVLPGHVYLAPGGETHMRL
GRSGANYVIELEASEPVNRHRPSVDVLFNSAAAAAGKNAIGVILTGMGKDGAAGMLAMRR
AGAHTIAQDEASCVVFGMPREAIAIGAADEVVSLSAMSERILTRLGDRGHRV
Download sequence
Identical sequences A0A095UWR8
WP_043545107.1.95437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]