SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A095XBJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095XBJ2
Domain Number 1 Region: 266-312
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000161
Family AraC type transcriptional activator 0.027
Further Details:      
 
Weak hits

Sequence:  A0A095XBJ2
Domain Number - Region: 136-234
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.011
Family Capz beta-1 subunit 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A095XBJ2
Sequence length 319
Comment (tr|A0A095XBJ2|A0A095XBJ2_9FIRM) AraC family transcriptional regulator {ECO:0000313|EMBL:KGF07193.1} KW=Complete proteome; Reference proteome OX=1230730 OS=Tissierellia bacterium S5-A11. GN=HMPREF1633_15645 OC=Bacteria; Firmicutes; Tissierellia.
Sequence
MENFESLINAYVSSELKDENYFHPLGRYYIANTKLYNGYYWYYESSDFIIDIHNLFIKED
FVEDGVESMQNYVTLISNFVMSGNGEWFNPYQSIEPFSMFVMDPSDKKNRYLIHKNSRLC
LVGVKFKKSFLEKYYPPYSYSNNVDDLKDMFFQSKNSIINPISKIAKDILTCKLENAEAK
LFFEEKVKEWFYITVEASEDSKNFKPLSTEDEKLIENVERYISDHYSNNIPQSLLEKIAC
MSGTKLKESFKKKNNLSITEFTQRKRMNIAEQLLVTTDLEIRHIAKTVGYTSASRFSKLY
KRYKGVYPNEVKIMINLNK
Download sequence
Identical sequences A0A095XBJ2 C2CI61 U7V0N8
WP_004837815.1.14403 WP_004837815.1.37474 WP_004837815.1.44164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]