SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A095XY51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095XY51
Domain Number 1 Region: 5-181
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.88e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A095XY51
Sequence length 185
Comment (tr|A0A095XY51|A0A095XY51_9FIRM) 2-oxoacid:ferredoxin oxidoreductase subunit gamma {ECO:0000313|EMBL:KGF14746.1} KW=Complete proteome OX=1219626 OS=Peptostreptococcus sp. MV1. GN=HMPREF1639_02025 OC=Peptostreptococcaceae; Peptostreptococcus.
Sequence
MSTSRVICAGFGGQGVMSMGQLMTYAGMLENKEVSWLPSYGPEMRGGTANCAVTISDQPV
GSPIITDDATAAIIMNSPSLTKFEGDVVPGGVILINSSLVHEKCSRDDIEAYYVDANDLS
NELGGSKFANMIMLGAFLAVDNSVNIDSVLEAFKKVFGKRKEKFIPVNRQALEAGYKAVM
DQKNK
Download sequence
Identical sequences A0A095XY51
WP_036762710.1.101162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]