SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095ZBW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095ZBW5
Domain Number 1 Region: 6-201
Classification Level Classification E-value
Superfamily ITPase-like 3.4e-62
Family ITPase (Ham1) 0.00000765
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A095ZBW5
Sequence length 206
Comment (tr|A0A095ZBW5|A0A095ZBW5_9BURK) Nucleoside-triphosphate pyrophosphatase {ECO:0000256|HAMAP-Rule:MF_01405} KW=Complete proteome; Reference proteome OX=1401065 OS=Oligella urethralis DNF00040. GN=HMPREF2130_02050 OC=Alcaligenaceae; Oligella.
Sequence
MSLLTTLDEIVLASNNQGKLKEFVALFNQYGISIRTQGEFHVAECDEPFHTFLENALAKA
RHASKETGLAAIADDSGIVVPALKGFPGVMSARYATLFGEPKSDANNNACLIRQLQAHSD
KSAAYLAVLVFVRHADDPAPIVAQSWWHGVIVEEPRGANGFGYDPHFYLPDYGLTAAEME
PTLKNSLSHRAAALKKLIAEMDEAQQ
Download sequence
Identical sequences A0A095ZBW5
WP_036557613.1.87501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]