SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A096AJZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096AJZ6
Domain Number 1 Region: 2-179
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.44e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096AJZ6
Sequence length 180
Comment (tr|A0A096AJZ6|A0A096AJZ6_9BACT) 2-oxoglutarate ferredoxin oxidoreductase subunit gamma {ECO:0000313|EMBL:KGF47418.1} KW=Complete proteome OX=1401073 OS=Prevotella melaninogenica DNF00666. GN=HMPREF0661_07260 OC=Prevotella.
Sequence
MKKEIIISGFGGQGVLSMGKILAYSGLMEDKEITWMPAYGPEQRGGTANVTVIISDDRIS
SPILSKYDVAIVLNQPSLDKFEPKVKPGGLLIYDGYGVFNPPTRKDITIYRINAMDKAAE
MKNAKVFNMIVLGGLLKVCPVVSTDGLKKALFKSLPERHHKLIPLNMEAVEEGMKIIAQQ
Download sequence
Identical sequences A0A096AJZ6
WP_036865103.1.62975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]