SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096AQ34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096AQ34
Domain Number 1 Region: 48-169
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 1.1e-42
Family Insert subdomain of RNA polymerase alpha subunit 0.0000404
Further Details:      
 
Domain Number 2 Region: 4-48,170-224
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 1.81e-29
Family RNA polymerase alpha subunit dimerisation domain 0.001
Further Details:      
 
Domain Number 3 Region: 246-309
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 2.49e-22
Family C-terminal domain of RNA polymerase alpha subunit 0.0000753
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096AQ34
Sequence length 311
Comment (tr|A0A096AQ34|A0A096AQ34_9FIRM) Transcriptase subunit alpha {ECO:0000256|HAMAP-Rule:MF_00059} KW=Complete proteome; Reference proteome OX=1401070 OS=Peptoniphilus lacrimalis DNF00528. GN=HMPREF2134_09230 OC=Peptoniphilus.
Sequence
MIEFEKPNITKIDENKDYGKFVIEPLERGYGTTLGNSLRRVLLASLPGAAVTSIDIDGVL
HEFDTIPGVREDVMQIILNIKGIAVKSYVKDEKTIELDVEGPAEVTAGDILTDSDIEIVN
PDHYLFTIGEGASFKATMTVNTGRGYVPADENKKDNAPVGTLAVDSIYTPVTKVNYQVEP
ARVGSNDGFDKLTLEILTNGTIIPEDALGLSARILTEHLDLFTNLTEIAKSAEVMKEADT
ESDDRILERTIEELDLSVRSYNCLKRAGINTVHDLTEKSEAEMMKVRNLGRKSLEEVKLK
LIDLGLGLKDK
Download sequence
Identical sequences A0A096AQ34 A0A1F0T9Z4 A0A1N1WPD7 E8K1L4 J1SEK8
WP_004251121.1.101565 WP_004251121.1.23718 WP_004251121.1.69269 WP_004251121.1.904 WP_004251121.1.92239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]