SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A096CFF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096CFF9
Domain Number 1 Region: 3-177
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.22e-39
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096CFF9
Sequence length 182
Comment (tr|A0A096CFF9|A0A096CFF9_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:KGF53647.1} KW=Complete proteome OX=742738 OS=Clostridium orbiscindens 1_3_50AFAA. GN=HMPREF9460_03467 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Flavonifractor.
Sequence
METNLCVAGFGGQGVMTLGKFLADATCNSTDKNVTFFPSYGAEQRGGTANCFVVISDDPI
GAPLGDVMDDLIVMNGPSLKKFIGTLKSGGTLFINSSIVSDDIGRDDVKLVKAPVTELAL
EMGNAKVLNVIMLGVYVGYTEVIDPAIVWQTIEHKLSSKPKLLPLNRQAFEKGLELGRAQ
KQ
Download sequence
Identical sequences A0A096CFF9
WP_044942857.1.29922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]