SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A096D347 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096D347
Domain Number 1 Region: 236-497
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.71e-58
Family PFOR Pyr module 0.039
Further Details:      
 
Domain Number 2 Region: 16-249
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.57e-16
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.023
Further Details:      
 
Domain Number 3 Region: 512-617
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.27e-16
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096D347
Sequence length 632
Comment (tr|A0A096D347|A0A096D347_9BACT) MFS transporter {ECO:0000313|EMBL:KGF51929.1} KW=Complete proteome OX=1401066 OS=Prevotella amnii DNF00058. GN=HMPREF9302_05305 OC=Prevotella.
Sequence
MDSQIEVKDLDHVVVHFSGDSGDGMQLAGNIFSTVSATVGNGISTFPDYPADIRAPQGSL
TGVSGFQVHIGAGKVYTPGDKCDVLVAMNAAALKMQYHHCKPQSIIIIDTDGFNSRDLKK
AEFSSEDYLQEMGIDPDFVIACPIAAMVKDCLSTSGMDNKSVLKCRNMFALGLVCWLFNR
DIELVNNYLNKKFAKKPHLAEANIKVVQAGYDYGANTHSSVPNTYRVETTDKTPGRYMDI
TGNKATAYGLIAAAEKAGLRLFLGSYPITPATDILHELAKHKSLGVTTVQCEDEIAGCAS
AIGAAFAGALAATSTSGPGICLKSEAMNLAVIDELPLVIIDVQRGGPSTGMPTKSEQTDL
LQVLYGRNGESPMPVIAATSPTDCFDAAFHACKIALEHMTPVVLLTDAFIANGSSAWKLP
NIDDLPDINPHFATEDMKYKYTPYKRDKENLARYWAIPGKEGYTHILGGLEKDGETGAIS
TDPENHDKMDHLRWEKVARIKVPDLEVLGDKNDAELLIVGFGSTYGHLYATMNELRKKGY
KVALAQFKYINPLPKNTPEVLAKYNKVVVAEQNLGQLAALLRIRINNFAPYQYNKVKGQP
FVVSELVKQFENLIKESLPKENKGTFYDKILQ
Download sequence
Identical sequences A0A096D347
WP_036855392.1.45999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]