SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A096DUU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096DUU4
Domain Number 1 Region: 749-993
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.4e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0099
Further Details:      
 
Domain Number 2 Region: 29-206
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.18e-18
Family Pyruvate oxidase and decarboxylase Pyr module 0.049
Further Details:      
 
Domain Number 3 Region: 460-648
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.27e-16
Family Pyruvate oxidase and decarboxylase PP module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096DUU4
Sequence length 1192
Comment (tr|A0A096DUU4|A0A096DUU4_COMTE) MFS transporter {ECO:0000313|EMBL:KGH15857.1} KW=Complete proteome OX=285 OS=Comamonas testosteroni (Pseudomonas testosteroni). GN=P368_00915 OC=Comamonadaceae; Comamonas.
Sequence
MNAPLPDEVRRALESVTLDDKYSLARGRAFMSGVQALVRLPMLQRLRDAQAGLNTAGFIS
GYRGSPLGTYDQSLWAAKKHMEANHIVFQPGVNEELGATAVWGTQQLDLYPETKKFDGVF
GIWYGKGPGVDRCSDVFKHANMAGTAKHGGVIAIAGDDHISKSSTAAHQSDHIFKACGTP
VFFPSNVQDILDMGLHAFAMSRFSGLWSGMKTIQEVVESSSSVLVDPDRVNIILPEDFQM
PDGGLHIRWPDPPLEQEARLMNYKWYAALAYVRANKLNHNVIEGPNDRFGIIASGKAYND
TRQAMADLGLDEDTCRQLGIRLHKVNVVWPLEATITRDFARGLQEILVVEEKRQVIEYQI
KEELYNWRDDVRPNVVGKFSDEHGGEWSLPNPSTDWLLRPTADLTPAIIARAIAQRLKKL
GVPEHVQTRMQQRLAVLDAREAAIKAAKEVSTGDRTPWFCSGCPHNTSTRVPEGSRAVAG
IGCHYMTTWMPDRRTSTFTQMGGEGVTWVGQAPFTKEAHVFANLGDGTYFHSGLLAIRQS
IAAGTNITYKVLYNDAVAMTGGQRVGERPEGHSVLQIMNSLLSEGVGKLVIVTDEPEKYD
GVKLGEGVTVHHRDELDAIQRQFRELKGCTAIIYDQTCATEKRRRRKRGVLSTPDKTVVI
NELVCEGCGDCSVQSNCLSVEPVETEFGRKRRINQNSCNKDYSCVKGFCPSFVTVEGGQL
KKPKQEKKGSLEALPHIPEPVLPVAEQAWGIVVAGVGGTGVITIGSLLGMAAHLEGKGVV
TQDAAGLAQKGGSTWSHIQIANRADAIYTTKVDMAKADLVIGCDPIVAATPTTLSVMQPG
RTYVALNSHAAPTATFVGNPDWQSPAARCATALAEAVGHGALGSFDAEKASTALLGDSIY
ANPMMLGYAWQKGRVPLSHASLMRAMELNGVQVARNQEAFEWGRRCAHDLEAVRALYQAS
QVIQFVKKPSLEEMLDKRVEFLTAYQNAAYAQQYRDFVAKVRAVEEPLAQGTRLSQAVAR
YLFKLMAYKDEYEVARLHTDAAFTQKISEMFEGDYKLVHHLAPPGFAKKDEQGHLLKKSY
GPWMRKAMGWLAGMKGLRGTALDPFGRTEERRTERALIVEYRQCIETLLTGLTADKLALA
VEIASIPEDIRGYGHVKEHHLAAARIKWQSLMTRWNGSAAPAAPAVKLMAVN
Download sequence
Identical sequences A0A096DUU4
WP_034351015.1.14265 WP_034351015.1.18613 WP_034351015.1.52991 WP_034351015.1.67309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]