SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A096M0N2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096M0N2
Domain Number 1 Region: 231-408
Classification Level Classification E-value
Superfamily MIR domain 4.32e-45
Family MIR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1091-1182
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.69e-19
Family SPRY domain 0.07
Further Details:      
 
Domain Number 3 Region: 4000-4078
Classification Level Classification E-value
Superfamily EF-hand 0.000000221
Family Calmodulin-like 0.044
Further Details:      
 
Domain Number 4 Region: 671-811
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000317
Family SPRY domain 0.06
Further Details:      
 
Domain Number 5 Region: 447-560
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000497
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 
Domain Number 6 Region: 1411-1534
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000206
Family SPRY domain 0.024
Further Details:      
 
Domain Number 7 Region: 113-198
Classification Level Classification E-value
Superfamily MIR domain 0.00000327
Family MIR domain 0.028
Further Details:      
 
Domain Number 8 Region: 2146-2214
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000379
Family IP3 receptor type 1 binding core, domain 2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096M0N2
Sequence length 4949
Comment (tr|A0A096M0N2|A0A096M0N2_POEFO) Ryanodine receptor 3 {ECO:0000313|Ensembl:ENSPFOP00000024973} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MAEGGEGEDEIQFLRTDDEVVLQSVATILKEHRKFCLAAEGLGNRLCYLEPTSEAKYVPP
DMCICNFVLEQSLSVRALQEMLANTGTSSEGKADHEKWRLIKKAGQGGGHRTLLYGHAIL
LRHSFSDMYLTCLKTSRSLTDKLSFDVGLQEDSVGEACWWTIHPASKQRSEGEKVRIGDD
LILVSVSTERYLHLSNCNGNIQVDASFMQTLWNVQPTCSSGSMAVEGYLIGGHVMRLCHG
HDESLTIPGADKSEEEQRIVNYEAGKGASRARSLWRLEPLRISWSGSHIRWGQSFRLRHL
STGRYLALTEDRGLVLEDREKCHTKATAFCFKPSKEKGDSGMKRDIDGMGVPEIKYGDSV
CFVMHVATGLWLSYLAPDAKSSRLGPLKRRACLHSEGHMDDGLILQRCQHEESRAARIIR
NTTFLFKNFIKALDSAAAGETNAVAGYVEEVLQTLNDLIEYFKQPDVDLEHEEKQARLRS
LIKQQDLFKEEGMLALLSKCIDRMNLYDSAAHFGEMAGEEAGAAWKDILNLLYELLAALI
RGNRTNCTQFSRNLDWLVSKLERMESSSGILEVLHCILVESPEALNIIQKGHIKSIISLL
YKHGRNHKILDVLCSLCVCNGVAVRTNQNLICDNLLPKRDLLLQTRLVNDVQSMRPNIFL
GIAEGSAQYKKWYYELVIDQVDHFVTGEPTHLRVGWANTKGYAPYPGGGEGWGGNGVGDD
LYSYSFDGLHLWSGRIPRAVASINQHLLNSDDVVSCCLDLGAPSMSFRINGQPVQGMFED
FNTDGFFFPVVSFSAGVKARFLLGGRHGDFKFLPPAGYSPCYEALLPKEKMHVEPVKEYK
RDHDGVRDLLGTTQFLSQASFIPTPVDTSQIVLPPHLENIRDKLAENIHELWGMNKIELG
WTYGKVRDDNKRQHPCLVDFSKLPETEKNYNVQMSSETLKTLLALGCHVAQVNVHAEEDL
KKIKLPKDYMMSNGYKPAPLELSDVKLTPGQEVLVDKLAENAHNVWAKDRIKQGWTYGIQ
QDVKSRRNPRLVPYALLDERTKKSNRDSLREAIRTMVGYGYDIDPPDQTKVVHAIDNQSI
ETIRFFRVEQTYAVKTGKWYFEFEVLSGGDMRVGWARPGCRPDVELGTDDQAYVFDGYRG
RRMHAGSRYFGHPWKKGDVVGCMINMEDKSMIFTLNGELLITSKGSELGFADFETEDGFI
PVCSLGMSQIGHMNLGKDASTFKYYTMCGLQEGFEPFAVNMNREITMWFSKRLPTFFNVP
QDHMHIEVTRIDGTVDSPPCLKVTHKTFGTQNSNSDMVYCRLSMPVEFYSADRLLDESLK
LRLRFHPHYSLFFSFNKTINVSNVVWKRMDGVELKCFPGMDESFVYSSIHLFPFSQLLSE
TFYLNMFVFFSQPPKEDGSIDYLFLFLNLQYYHSVRVFAGQDPASVWVGWVTPDYHYYSK
NFSLSKTQTVTVTLGDERGRVHESIQRSNCYMVCAADALGPSSSSRSNTDLEIGCLVDLA
TGLVSFTANGKELPTAYQVEPNTKLFPAVFCCPTSSNLFQFEFVKIKDAMPLSSAMFRSE
QRNPVPQCPPRLDVQTIVAVLWSRMPNTFLNVETARVSERHGWVVQCLEPLQMMAVHIPE
ENRCLDIMELSEHEDLRKFHSHTLKLYCALCALGNTRVAHALCSHLDQSQLLYTIDNQYL
SGMLREGFYDVLISIHLETAKEARLMMNNEFIIPVTDETRSIKLFPDESKRHSLPGVGLS
TSLKPRVNFSPVGIISTKRHQLLYSPQIPLGILKEKAISMLTEAVQGGGSHIRDPVGGSL
EYQFVPILKLIGTLLIMGVLTSDEVRLILLLIEPNVFGEAKEGEEGSEVVVAGEKEEVSK
NEEKAVEAGEEETKESKPAAKGLLEKSLPESVKHQMCELLHYFCDCELQHRIEAIVSFSD
RFVSKLQYNQKFRYNELMQAFNMSAAVTAKKTKEFRSPPHEQINILLNFSAGEDCPCPEE
IQDELTSFHEELRLHCGIPVEEQEEEQDTSIKGRLLALLYKIKGPPQKTEEQPAETEQAA
PTNLKELISQTITSWAQESHIQNPELVRVMFSLLRRQYDGIGELLRAMKKSYTISAASVQ
DGINLLVSLGQIRSLLSVRMGKEEEKLMIDGLGDIMNNKVFYQHPNLMRVLGMHETVMEV
MVNVLGGDKSQEIAFPKMVASCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASEAM
RGSTPLDVAASSVMDNNGLALALEEPDLEKVVMYLAGCGLQSCAILVAKGYPDLGWNPIE
GERYLSFLRFVVFCNGESVEENANVVVKLLIRRPECFGPALRGEGGQGLLAAMKEAIKIS
EDPALDLPKSPAGATAGSGEEEGEVIHMGNAIMSFYSALIDLLGRCAPEMHLINAGKGEA
LRIRAILRSLVPTSDLVGIISIPLKMPVINKDGSVTEPDMSACFCPDHKAPMVLFLDRVY
GIEDQSFLLQMLEVGFLPDLKASASLDTEVLSTTETALAMNRYIGSALLPLLTRCAALFG
NTEHYAHLVDSTLETIYRLSKGRSLTKAQRDAIEECLLAICKHLRPSMMQQLLRRLVFDV
PLLTEYCKMPLRLLTNHYEQNWKYYCLPSGMGGFGMASEEELLLTKKLFWGIFDSLSQKK
YDSELFKMAKSCLCAIAGALPPDFVDTSLGATVEKQESVDAQGNFEPKPINTANISLPEK
LDYIANKYAEHSHDKWASEKMSAGWKHGDSLDEQAKAHPLLKPYKSLSEKERETYRWPVK
ESLKSMLAMNWNIERTKEGEAMFQQRESEKQRKLSETQFVQSNGFSPAPMDLHNVTLSRE
LQSMVEVVAENYHNIWAKKKKSELLSKGGGLAHPLLVPYDTLTAKEKYRDKEKAQELFKF
LQISGYAITSLRGLKDMEQDSSSMEKRFAYKFLKRLLKNIDSAQEFIAHLEAMATSGKTD
KSPHDQEIKFFAKVLLPLIDQTFKNHCLYFLSTPSKNLSSCGCASNKEKEMLTSLFCKMA
ALVRHRISLFGSDSAIMVSCLHILSHSLDTRTVMKSGAELVKVGFKAFFENAAEDLEKLV
EMLKLGKFMQSRAQMKSVTQSINYVTVALLPILTALFEHTRTHEFDVDLLVDDVQLSCYR
ILMCFYSLGTGKNVFVERHLPAIGESLATLVGAMPVAFLEPHLNAHNPLSVFNTKTPRER
AILSMPDTVEEMCPEMPRLDKLLKDVNDVSECGARYSDMPQVIEVVLPMLCNYLSYWWEK
GPENSPPDTDCCTMVTSEHLSIILGNILKILNNNLGIDDAPWMKRIAVYSQPIICKAGAD
LLRTHFLPTMEKLKKKTVKVVSEEELLKADGKGDNQEAELLILDEFAVLCRDLYAFYPML
IRYVDNNRSRWLKEPDADSTELFRMVAEIFILWCKSNNFKREEQNFVIQNEINNLGFLTG
EGKSKMSKQSGGDQERKHKRRRGEYYSIQTSLIVAALKKLLPIGLNMCTPGDQELISLAK
IRYSLKDTDDEVKEHLRQNLHLQEKSDDPAVHWQLNLYKDVVVKSEEPSDSEHTVDRIQS
ISAAVFNLEQVKIISNTNEDCCVEQPLRNKKCIVQKLLSKQRKRAVVACFRMAPLYNLPR
HRAINFFIPAYERLWIAAEEYSFEEKLVQDLAKTPMKIVEEEEEEVAEIKPDPLHQLILH
FSHNALTERSHLEVDPLYIAYADMMAKSCAEDEEEEEEEGREKTFEEKEMEKQKILYQQA
RLHARGAAEMVLQMISASKGRLGPMVTCTLKLGISILNGGNVQVQQKMLGYLTDKRDAGF
FKSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSSSKVLQNDEFTKDLFRFLQLLCEG
HNGDFQNFLRTQTGNTTTVNIIISTVDYLLRLQESISDFYWYYSGKDVIDETGKHNFSKA
LSVAKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDASQIELLK
ELMDLQKDMVVMLLSLLEGNVVNGTIGKQMVDTLVESSSNVEMILKFFDMFLKLKDLTTS
DNFKEYDPECKGIISKKEFQKSMESQKQYNQSEIEFLLSCAEADENDMFNYKEFVERFHE
PAKDIGFNVAVLLTNLSEHMPHDTRLATFLDLAESVLSYFEPYLGRIEILGSAKRIERVY
FEISESSREQWEKPQVKESKRQFIFDVVNEGGESEKMEMFVNFCEDTIFEMQLASQISEP
DAVEQPEEEEEEEVHNILEELSGGDAAALESTSAFTTACRSVKKSLSEIRQIFTIKTARK
QFKKIKKLSIKELITGFFSFFWMIFIGFFKGIISLVFGFFHVIWSSMFGGGLVEGAKNIK
VTDILGNMPDPTQFGIHGDVGEGDKVEAMESSGSLDKAMAPAGDATENSDSEKEIEVVIL
KKYRCFSQLPSCVLLSCSDSKFPSSNKTVLQKAAAKTAAPSESETEKADTETREKEDKPK
EEEAKEPAVEEKPKPRSSQPKEASPAFMSTVFAILDVYLNKILNYLARNFYNLRFLALFV
CFAINFILLFYKVTGEAEEEEEDEENHWGDDDDENTLFDMDEFVLQESTGYMLPTLRFLA
IFHTVISLLCLVGYYCLKVPLVVFKREKEIARKLEFDGLYITEQPSDDDIKGQWDRLVIN
TPSFPNNYWDKFIKRKVINKYGDMYGAERIAELLGLDKSALDFDPTVETVEKEASLLSWL
SSIDTKYHIWKLGVVLTDNYFLYLIWYTTMSIFGHFNNFFFAAHLLDIAMGFKTLRTILS
SVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMY
VGVRAGGGIGDELEDPAGDPYELYRILFDITFFFFVIVILLAIIQGLIIDAFGELRDQQE
QVKEDMETKCFICGIGNDYFDRTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQES
YVWKMYQERCWDFFPAGDCFRKQYEDQLG
Download sequence
Identical sequences A0A096M0N2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]