SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096M276 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096M276
Domain Number 1 Region: 9-80
Classification Level Classification E-value
Superfamily RING/U-box 2.29e-22
Family RING finger domain, C3HC4 0.039
Further Details:      
 
Domain Number 2 Region: 140-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.75e-16
Family B-box zinc-binding domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096M276
Sequence length 268
Comment (tr|A0A096M276|A0A096M276_POEFO) Uncharacterized protein {ECO:0000313|Ensembl:ENSPFOP00000025517} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MEQQAGQLDPETFSCSICLDLLKDPVTIPCGHSYCMNCIKNFWDGGEKKKICPQCRKTFT
PRPDLEKNTMLAALVEQLKKTGLQAAPADHRYAGPEDVACDFCTGRKLKAIKSCLVCLAS
YCEKHLQSHYDVAPLRKHKLVEPSKNLQENICSRHNKVIDIFCCTDQKCICYLCSVDEHK
GHDTVSAAAERTERQRELEERRGNIQQMIQDQEKDVKLLQQEVEAINRSADKTVEDSEKI
FTELIRLLQKRSSEVKQQIRSQQETEVS
Download sequence
Identical sequences A0A096M276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]